PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008464-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 400aa    MW: 44009.7 Da    PI: 6.7952
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008464-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
    NNU_008464-RA 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.89e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
    NNU_008464-RA  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.914961IPR017930Myb domain
SuperFamilySSF466891.36E-3011108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001671.60E-111661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002494.8E-1667112IPR001005SANT/Myb domain
CDDcd001671.57E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPKS DALSSVDGQS KTAATLSHMA QWESARLEAE TRLVRESKLR SSSFQHQLGL  180
SASDSGSTSS QLLNKTSSDP PASSQCLDVL KAWQGVWSKS SKMGAISGLV NGRDLESPTS  240
TLSFSENAVP IPTVGYGDNP TTTTELVGNS STYGGGVVKE EGEEDWEGLG KSIHLPEYKE  300
RMENSVTFMT GFQDSVFAAE DSWTSESSKT GNGHVPSSNF IDGFTDLLLN HSDDRNSSDG  360
SRDSHNANGS RGTNDYEENK NYWNNILNLV NSSPSDSPVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258286.10.0PREDICTED: transcription factor MYB34-like
TrEMBLC6G4160.0C6G416_THATH; MYB transcription factor ML2
STRINGPOPTR_0017s12230.11e-171(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-118myb domain protein 16